PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010424.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 584aa    MW: 62688.4 Da    PI: 9.2458
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010424.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-18103137135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C++Cgt +Tp+WR+gp+g  tLCnaCG++yr+ +l
  Do010424.1 103 CRHCGTDTTPQWREGPEGRNTLCNACGVRYRSGRL 137
                 *******************************9885 PP

2GATA48.51.2e-15310341132
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                 C++Cgt kTp+W +gp+g +tLCnaC +++r+
  Do010424.1 310 CQQCGTEKTPQWLEGPEGRSTLCNACVVRFRS 341
                 ******************************97 PP

3GATA56.24.7e-18498532135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C++Cgt kTp+WR+gp+g  tLCnaCG++y++ +l
  Do010424.1 498 CRHCGTGKTPQWREGPEGRQTLCNACGVRYKSGRL 532
                 *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577165.7E-1596158No hitNo description
PROSITE profilePS5011413.52197133IPR000679Zinc finger, GATA-type
SMARTSM004014.0E-1897147IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.1E-1498134IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.05E-15102152No hitNo description
PROSITE patternPS003440103128IPR000679Zinc finger, GATA-type
PfamPF003209.3E-17103137IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.9E-9303341No hitNo description
PROSITE profilePS5011410.515304340IPR000679Zinc finger, GATA-type
SMARTSM004012.8E-10304354IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.9E-11305342IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.05E-8309341No hitNo description
PfamPF003201.5E-13310341IPR000679Zinc finger, GATA-type
PROSITE profilePS5011413.125492528IPR000679Zinc finger, GATA-type
SMARTSM004016.2E-17492542IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.6E-15495530IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.04E-14495554No hitNo description
CDDcd002024.74E-13497554No hitNo description
PROSITE patternPS003440498523IPR000679Zinc finger, GATA-type
PfamPF003205.1E-16498532IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MVVVDALHGD SAAAVVDDLF GGGADIQAFF DYAALEVKAS GGEEGEEELE WLSNKDAFPA  60
VETMAPSAPR QRTKGVPRPR WEGVWSPRQA PVVALAPAAG RRCRHCGTDT TPQWREGPEG  120
RNTLCNACGV RYRSGRLVPE YRPASSPTFS PQLHSNRHSR VVELRRRREE AAQASLAAAG  180
NGEEKGNEKL EQLSNKGEFL AVQMMAAAAA ARPRTEGIRR PRTEGIRRPR KAVAWSPPPP  240
PRALVVAERR PNQDGEAGAA IEQGRAPDGG DDGVDGCVAA DQGIAAVPAD GGLNPAAPLA  300
PAAATAGRRC QQCGTEKTPQ WLEGPEGRST LCNACVVRFR SGFIVPVLLP ASSLAYFPEL  360
RFDWHNRVKL HRRLERSAKF PPATAGVGEE GKEELEWPSN NDAFPAVKAM PLAGARPQTK  420
DVRRRRRRQQ VVELSPPRTP PPPRRRSRLG GEAVAVEQGR VGDGGAAAVE GRAVVPAGGG  480
EEEEPAAPLA PAVSGRQCRH CGTGKTPQWR EGPEGRQTLC NACGVRYKSG RLVPEYRPES  540
SPTFTPGVHS NRHHQVVQLR RRREGSVEVS AAVASAAAAF LLDD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1422427RRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982957.10.0PREDICTED: uncharacterized protein LOC101761214
SwissprotQ6DBP82e-30GAT11_ARATH; GATA transcription factor 11
TrEMBLK4A7L50.0K4A7L5_SETIT; Uncharacterized protein
STRINGSi034871m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP157091414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.13e-27GATA transcription factor 1